PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008225989.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 354aa    MW: 40371.6 Da    PI: 4.4417
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008225989.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.54.2e-5661331128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v 
  XP_008225989.1   6 LPPGFRFHPTDEELVAYYLDRKINGRTIEL-EIIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVN 99 
                     79****************************.99**************96435566888************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s +++ vg+kktLv+y+grap+g +t+Wvmheyrl
  XP_008225989.1 100 S-QQRPVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                     9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-643157IPR003441NAC domain
PROSITE profilePS5100560.4316157IPR003441NAC domain
PfamPF023656.5E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKING RTIELEIIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRAVNS QQRPVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLVDSVCGN ASSSLKDSYA LCRVFKKTIQ MPKNNKEEKP IGIDNAENDS  180
VWVSNNEQLL GEDNSGINET ASRGIETDQD ENYSNHDYPK FLSDTSSSDL TQGTPTENGI  240
ADDFQAPFAS DEANSSADLY SFGVRCSSNL IDQETYIPHN ESLLNNYQFP YPPLELEDFP  300
QINLAAEANA SKPEIIDDYM SYDKFKDYMN GTFEEIFSLC SSQDNSAALP MQEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-60115712165NO APICAL MERISTEM PROTEIN
1ut4_B6e-60115712165NO APICAL MERISTEM PROTEIN
1ut7_A6e-60115712165NO APICAL MERISTEM PROTEIN
1ut7_B6e-60115712165NO APICAL MERISTEM PROTEIN
3swm_A6e-60115715168NAC domain-containing protein 19
3swm_B6e-60115715168NAC domain-containing protein 19
3swm_C6e-60115715168NAC domain-containing protein 19
3swm_D6e-60115715168NAC domain-containing protein 19
3swp_A6e-60115715168NAC domain-containing protein 19
3swp_B6e-60115715168NAC domain-containing protein 19
3swp_C6e-60115715168NAC domain-containing protein 19
3swp_D6e-60115715168NAC domain-containing protein 19
4dul_A6e-60115712165NAC domain-containing protein 19
4dul_B6e-60115712165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008225989.10.0PREDICTED: protein BEARSKIN1
TrEMBLM5WNI40.0M5WNI4_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s18180.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.11e-109NAC domain containing protein 20